Products

Croyez GMP ® IFN gamma (Interferon gamma), Human

Interferon gamma (IFN gamma) is an effective multifunctional cytokine which is released mainly by activated NK cells and T cells. IFN gamma is primarily characterized based on its anti-viral activities, and then been proved to have several functions such as anti-proliferative, immune-regulatory, and pro-inflammatory activities. IFN gamma can upregulate expression of MHC class I and II antigen by antigen-presenting cells.
No. Size Price Qty Status
C01080-GMP-100 100 ug $520.00 Inquiry
C01080-GMP-1000 1 mg $2,200.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDD
FEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ with polyhistidine tag at the C-terminus

UnitProt ID:
P01579

Species of Origin:
Human
 
Expression System:

Escherichia coli
 
Endotoxin level:

<0.05 EU per 1 μg of the protein by the LAL method.
 
Activity:
Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human IFN gamma is approximately >2 x 106 IU/mg, which is calibrated against the human IFN Gamma WHO Reference Material (NIBSC code: 87/586).
 
Purity:
>98% as determined by SDS-PAGE analysis.
 
Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
 
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping conditions:
Blue ice
 

Background Information
Interferon gamma (IFN gamma) is an effective multifunctional cytokine which is released mainly by activated NK cells and T cells. IFN gamma is primarily characterized based on its anti-viral activities, and then been proved to have several functions such as anti-proliferative, immune-regulatory, and pro-inflammatory activities. IFN gamma can upregulate expression of MHC class I and II antigen by antigen-presenting cells.

Quality Statement
Croyez GMP® recombinant proteins are manufactured in ISO 13485:2016 and GMP-certified facility.
The processes include:
●  Animal-free reagent and laboratory 
●  Manufactured and tested under GMP guideline
● Testing and traceability of raw material
● Records of the maintenance and equipment calibration
● Personnel training records
● Batch-to-batch consistency
● Documentation of QA control and process changes
● Manufactured and tested under an ISO 13485:2016 certified quality management system
● Stability monitor of product shelf-life

Quality Assurance
At Croyez, we are committed to providing our valued customers with detailed product analytics to assist in their research endeavors. Our Certificate of Analysis includes the following lot-specific details:
● SDS-PAGE analysis and endotoxin level evaluation conducted on bulk QC lots.
● Lot-specific bioassay results ensuring compliance with established parameters, including microbial testing meeting USP <71> standards.
● Mycoplasma detection via PCR analysis.

We believe in transparency and strive to empower our customers with comprehensive information to aid in their decision-making process.​
 


Measure by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is < 1 ng/ mL.
The specific activity of recombinant human IFN gamma is approximately > 2 x 106 IU/ mg.



To demonstrate lot-to-lot consistency of GMP IFN gamma, the activity of three separate lots was examined and plotted on the same graph.
1.
Wen YC, Tram VTN, Chen WH, Li CH, Yeh HL, Thuy Dung PV, Jiang KC, Li HR, Huang J, Hsiao M, Chen WY, Liu YN. CHRM4/AKT/MYCN upregulates interferon alpha-17 in the tumor microenvironment to promote neuroendocrine differentiation of prostate cancer. Cell Death Dis. 2023 May 4;14(5):304.
Reviews for Croyez GMP ® IFN gamma (Interferon gamma), Human

Average Rating: 0 (0 Reviews )